Structure of PDB 1sps Chain A Binding Site BS02

Receptor Information
>1sps Chain A (length=103) Species: 11886 (Rous sarcoma virus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
AEEWYFGKITRRESERLLLNPENPRGTFLVRESETTKGAYCLSVSDFDNA
KGLNVKHYKIRKLDSGGFYITSRTQFSSLQQLVAYYSKHADGLCHRLTNV
CPT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sps Binding of a high affinity phosphotyrosyl peptide to the Src SH2 domain: crystal structures of the complexed and peptide-free forms.
Resolution2.7 Å
Binding residue
(original residue number in PDB)
L64 D65 S66
Binding residue
(residue number reindexed from 1)
L63 D64 S65
Enzymatic activity
Enzyme Commision number 2.7.10.2: non-specific protein-tyrosine kinase.
External links
PDB RCSB:1sps, PDBe:1sps, PDBj:1sps
PDBsum1sps
PubMed7680960
UniProtP00524|SRC_RSVSA Tyrosine-protein kinase transforming protein Src (Gene Name=V-SRC)

[Back to BioLiP]