Structure of PDB 1sax Chain A Binding Site BS02

Receptor Information
>1sax Chain A (length=120) Species: 158879 (Staphylococcus aureus subsp. aureus N315) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NKTYEISSAEWEVMNIIWMKKYASANNIIEEIQMQKDWSPKTIRTLITRL
YKKGFIDRKKDNKIFQYYSLVEESDIKYKTSKNFINKVYKGGFNSLVLNF
VEKEDLSQDEIEELRNILNK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1sax On the transcriptional regulation of methicillin resistance: MecI repressor in complex with its operator
Resolution2.8 Å
Binding residue
(original residue number in PDB)		K4 E7 S9 S10 A11 S41 K43 T44 T47 R51
Binding residue
(residue number reindexed from 1)		K2 E5 S7 S8 A9 S39 K41 T42 T45 R49
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0045892 negative regulation of DNA-templated transcription
GO:0046677 response to antibiotic
Cellular Component
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1sax, PDBe:1sax, PDBj:1sax
PDBsum1sax
PubMed14960592
UniProtP68261|MECI_STAAN Methicillin resistance regulatory protein MecI (Gene Name=mecI)

[Back to BioLiP]