Structure of PDB 1s4v Chain A Binding Site BS02

Receptor Information

>1s4v Chain A (length=224) Species: 3988 (Ricinus communis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

TVPASVDWRKKGAVTSVKDQGQCGSCWAFSTIVAVEGINQIKTNKLVSLS
EQELVDCDTDQNQGCNGGLMDYAFEFIKQRGGITTEANYPYEAYDGTCDV
SKENAPAVSIDGHENVPENDENALLKAVANQPVSVAIDAGGSDFQFYSEG
VFTGSCGTELDHGVAIVGYGTTIDGTKYWTVKNSWGPEWGEKGYIRMERG
ISDKEGLCGIAMEASYPIKKSSNN

Ligand information

>1s4v Chain D (length=3) Species: 3988 (Ricinus communis) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

VLK

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1s4v The 2.0 A crystal structure and substrate specificity of the KDEL-tailed cysteine endopeptidase functioning in programmed cell death of Ricinus communis endosperm.
Resolution	2.0 Å
Binding residue (original residue number in PDB)	C26 H162
Binding residue (residue number reindexed from 1)	C26 H162

Enzymatic activity

Catalytic site (original residue number in PDB)	Q20 C26 H162 N183
Catalytic site (residue number reindexed from 1)	Q20 C26 H162 N183
Enzyme Commision number	3.4.22.-

Gene Ontology

	Molecular Function
GO:0008234	cysteine-type peptidase activity

	Biological Process
GO:0006508	proteolysis

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1s4v, PDBe:1s4v, PDBj:1s4v
PDBsum	1s4v
PubMed	15037072
UniProt	O65039\|CYSEP_RICCO Vignain (Gene Name=CYSEP)

[Back to BioLiP]