Structure of PDB 1rxw Chain A Binding Site BS02

Receptor Information
>1rxw Chain A (length=305) Species: 2234 (Archaeoglobus fulgidus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ADIGDLFEREEVELEYFSGKKIAVDAFNTLYQFISIIRQPDGTPLKDSQG
RITSHLSGILYRVSNMVEVGIRPVFVFDGEPPEFKKAEIEERKKRRAEAE
EMWIAALQAGDKDAKKYAQAAGRVDEYIVDSAKTLLSYMGIPFVDAPSEG
EAQAAYMAAKGDVEYTGSQDYDSLLFGSPRLARNLAIDVKPEIIILESNL
KRLGLTREQLIDIAILVGTDYNEGVKGVGVKKALNYIKTYGDIFRALKAL
KVVEEIRNFFLNPPVTDDYRIEFREPDFEKAIEFLCEEHDFSRERVEKAL
EKLKA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rxw Structural Basis for FEN-1 Substrate Specificity and PCNA-Mediated Activation in DNA Replication and Repair
Resolution2.0 Å
Binding residue
(original residue number in PDB)		L47 K48 T55 H308 D309 F310 S311 R314
Binding residue
(residue number reindexed from 1)		L45 K46 T53 H289 D290 F291 S292 R295
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0003677 DNA binding
GO:0003824 catalytic activity
GO:0004518 nuclease activity
GO:0004519 endonuclease activity
GO:0004527 exonuclease activity
GO:0008409 5'-3' exonuclease activity
GO:0016788 hydrolase activity, acting on ester bonds
GO:0017108 5'-flap endonuclease activity
GO:0046872 metal ion binding
Biological Process
GO:0006260 DNA replication
GO:0006281 DNA repair
GO:0043137 DNA replication, removal of RNA primer

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1rxw, PDBe:1rxw, PDBj:1rxw
PDBsum1rxw
PubMed14718165
UniProtO29975|FEN_ARCFU Flap endonuclease 1 (Gene Name=fen)

[Back to BioLiP]