Structure of PDB 1rrs Chain A Binding Site BS02

Receptor Information

>1rrs Chain A (length=345) Species: 1422 (Geobacillus stearothermophilus)

PAREFQRDLLDWFARERRDLPWRKDRDPYKVWVSEVMLQQTRVETVIPYF
EQFIDRFPTLEALADADEDEVLKAWEGLGYYSRVRNLHAAVKEVKTRYGG
KVPDDPDEFSRLKGVGPYTVGAVLSLAYGVPEPAVNGNVMRVLSRLFLVT
DDIAKPSTRKRFEQIVREIMAYENPGAFNEALIELGALVCTPRRPSCLLC
PVQAYCQAFAEGVAEELPVKMKVKQVPLAVAVLADDEGRVLIRKRDSTGL
LANLWEFPSCETDGADGKEKLEQMVGLQVELTEPIVSFEHAFSHLVWQLT
VFPGRLVHGGPVEEPYRLAPEDELKAYAFPVSHQRVWREYKEWAS

Ligand information

>1rrs Chain C (length=10)

gtccacgtct

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1rrs Structural basis for removal of adenine mispaired with 8-oxoguanine by MutY adenine DNA glycosylase
• Resolution: 2.4 Å
• Binding residue (original residue number in PDB): E43 L46 Q47 Q48 V51 G122 G124 Y126 T127 N144 N146 R149
• Binding residue (residue number reindexed from 1): E35 L38 Q39 Q40 V43 G114 G116 Y118 T119 N136 N138 R141

Enzymatic activity

• Catalytic site (original residue number in PDB): Y126 N144
• Catalytic site (residue number reindexed from 1): Y118 N136
• Enzyme Commision number: 3.2.2.31: adenine glycosylase.

Gene Ontology

Molecular Function

• GO:0000701 purine-specific mismatch base pair DNA N-glycosylase activity
• GO:0003677 DNA binding
• GO:0003824 catalytic activity
• GO:0016798 hydrolase activity, acting on glycosyl bonds
• GO:0019104 DNA N-glycosylase activity
• GO:0032357 oxidized purine DNA binding
• GO:0034039 8-oxo-7,8-dihydroguanine DNA N-glycosylase activity
• GO:0035485 adenine/guanine mispair binding
• GO:0046872 metal ion binding
• GO:0051539 4 iron, 4 sulfur cluster binding

Biological Process

• GO:0006281 DNA repair
• GO:0006284 base-excision repair
• GO:0006298 mismatch repair
• GO:0006950 response to stress

External links

• PDB: RCSB:1rrs, PDBe:1rrs, PDBj:1rrs
• PDBsum: 1rrs
• PubMed: 14961129
• UniProt: P83847|MUTY_GEOSE Adenine DNA glycosylase (Gene Name=mutY)