Structure of PDB 1rio Chain A Binding Site BS02

Receptor Information
>1rio Chain A (length=97) Species: 10710 (Lambdavirus lambda) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
STKKKPLTQEQLEDARRLKAIYEKKKNELGLSQESVADKMGMGQSGVGAL
FNGINALNAYNAALLAKILKVSVEEFSPSIAREIYEMYEAVHHHHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1rio Structure of a ternary transcription activation complex.
Resolution2.3 Å
Binding residue
(original residue number in PDB)		S2 K4 K5 M43 G44 S46 N56 N59
Binding residue
(residue number reindexed from 1)		S1 K3 K4 M42 G43 S45 N55 N58
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1rio, PDBe:1rio, PDBj:1rio
PDBsum1rio
PubMed14731393
UniProtP03034|RPC1_LAMBD Repressor protein cI (Gene Name=cI)

[Back to BioLiP]