Structure of PDB 1r8d Chain A Binding Site BS02

Receptor Information
>1r8d Chain A (length=109) Species: 1423 (Bacillus subtilis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKYQVKQVAEISGVSIRTLHHYDNIELLNPSALTDAGYRLYSDADLERLQ
QILFFKEIGFRLDEIKEMLDHPNFDRKAALQSQKEILMKKKQRMDEMIQT
IDRTLLSVD
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r8d The structural mechanism for transcription activation by MerR family member multidrug transporter activation, N terminus.
Resolution2.7 Å
Binding residue
(original residue number in PDB)		S15 R17 T18 H21 Y22 A36 Y38 R61 L62
Binding residue
(residue number reindexed from 1)		S15 R17 T18 H21 Y22 A36 Y38 R61 L62
Binding affinityPDBbind-CN: Kd=96nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1r8d, PDBe:1r8d, PDBj:1r8d
PDBsum1r8d
PubMed14985361
UniProtP71039|MTA_BACSU HTH-type transcriptional activator mta (Gene Name=mta)

[Back to BioLiP]