Structure of PDB 1r5w Chain A Binding Site BS02

Receptor Information
>1r5w Chain A (length=180) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEHTIIQAEFYLLPDKRGEFMFDFDGDEIFHVDIEKSETIWRLEEFAKFA
SFEAQGALANIAVDKANLDVMKERSNNTPDANVAPEVTVLSRSPVNLGEP
NILICFIDKFSPPVVNVTWLRNGRPVTEGVSETVFLPRDDHLFRKFHYLT
FLPSTDDFYDCEVDHWGLEEPLRKHWEFEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1r5w Evidence that structural rearrangements and/or flexibility during TCR binding can contribute to T cell activation
Resolution2.9 Å
Binding residue
(original residue number in PDB)		I36 E37 S39 Q57
Binding residue
(residue number reindexed from 1)		I34 E35 S37 Q55
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006955 immune response
GO:0019882 antigen processing and presentation
Cellular Component
GO:0016020 membrane
GO:0042613 MHC class II protein complex

View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1r5w, PDBe:1r5w, PDBj:1r5w
PDBsum1r5w
PubMed14690592
UniProtP04224|HA22_MOUSE H-2 class II histocompatibility antigen, E-K alpha chain

[Back to BioLiP]