Structure of PDB 1qn9 Chain A Binding Site BS02

Receptor Information

>1qn9 Chain A (length=183) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIR
EPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKI
QNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIF
VSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1qn9 Chain D (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgcccttttgtagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1qn9 TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
Resolution	1.9 Å
Binding residue (original residue number in PDB)	Q26 N27 R56 F57 R63 T70 L72 T82 V119 F148 P149 F165 S167 K169 V171
Binding residue (residue number reindexed from 1)	Q11 N12 R41 F42 R48 T55 L57 T67 V104 F133 P134 F150 S152 K154 V156

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qn9, PDBe:1qn9, PDBj:1qn9
PDBsum	1qn9
PubMed	10617571
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]