Structure of PDB 1qn6 Chain A Binding Site BS02

Receptor Information

>1qn6 Chain A (length=184) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRI
REPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFK
IQNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLI
FVSGKIVITGAKMRDETYKAFENIYPVLSEFRKI

Ligand information

>1qn6 Chain D (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tgccctattatagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1qn6 TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
Resolution	2.1 Å
Binding residue (original residue number in PDB)	Q26 N27 R56 F57 R63 T70 T82 V119 P149 F165 S167 V171
Binding residue (residue number reindexed from 1)	Q12 N13 R42 F43 R49 T56 T68 V105 P135 F151 S153 V157

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0005515	protein binding

	Biological Process
GO:0006352	DNA-templated transcription initiation

	Cellular Component
GO:0005634	nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1qn6, PDBe:1qn6, PDBj:1qn6
PDBsum	1qn6
PubMed	10617571
UniProt	P28147\|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]