Structure of PDB 1qn5 Chain A Binding Site BS02

Receptor Information
>1qn5 Chain A (length=183) Species: 3702 (Arabidopsis thaliana) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNPKRFAAVIMRIR
EPKTTALIFASGKMVCTGAKSEDFSKMAARKYARIVQKLGFPAKFKDFKI
QNIVGSCDVKFPIRLEGLAYSHAAFSSYEPELFPGLIYRMKVPKIVLLIF
VSGKIVITGAKMRDETYKAFENIYPVLSEFRKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1qn5 TATA Element Recognition by the TATA Box-Binding Protein Has Been Conserved Throughout Evolution
Resolution1.93 Å
Binding residue
(original residue number in PDB)
Q26 N27 R56 F57 R63 T70 T82 V119 P149 F165 S167 K169 V171
Binding residue
(residue number reindexed from 1)
Q11 N12 R41 F42 R48 T55 T67 V104 P134 F150 S152 K154 V156
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
Biological Process
GO:0006352 DNA-templated transcription initiation
Cellular Component
GO:0005634 nucleus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1qn5, PDBe:1qn5, PDBj:1qn5
PDBsum1qn5
PubMed10617571
UniProtP28147|TBP1_ARATH TATA-box-binding protein 1 (Gene Name=TBP1)

[Back to BioLiP]