Structure of PDB 1phj Chain A Binding Site BS02

Receptor Information
>1phj Chain A (length=449) Species: 200597 (Sterkiella nova) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KYEYVELAKASLTSAQPQHFYAVVIDATFPYKTNQERYICSLKIVDPTLY
LKQDASDYATLVLYAKRFEDLPIIHRAGDIIRVHRATLRLYNGQRQFNAN
VFYSSSWALFSTDKRSVTQEINNQDAVSDTTPFSFSSKHATIEKNEISIL
QNLRKWANQYFSSYSVISSDMYTALNKAQAQKGDFDVVAKILQVHELDEY
TNELKLKDASGQVFYTLSLKLKFPHVRTGEVVRIRSATYDETSTQKKVLI
LSHYSNIITFIQSSKLAKELRAKIQDDHSVEVASLKKNVSLNAVVLTEVD
KKHAALPSTSLQDLFHHADSDKELQAQDTFRTQFYVTKIEPSDVKEWVKG
YDRKTKKSSSLKKGDNIFQVQFLVKDASTQLNNNTYRVLLYTQDGLGANF
FNVKADNLHKNADARKKLEDSAELLTKFNSYVDAVVERRNGFYLIKDTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1phj Nucleotide Shuffling and ssDNA Recognition in Oxytricha Nova Telomere End-Binding Protein Complexes
Resolution2.5 Å
Binding residue
(original residue number in PDB)
Y65 K66 T67 Q69 Y72 S75 K77 F107 I112 Y130 Q135 D223 D225 Y239 T240 L260 K261 R274 S275 H292 Y293
Binding residue
(residue number reindexed from 1)
Y31 K32 T33 Q35 Y38 S41 K43 F68 I73 Y91 Q96 D184 D186 Y200 T201 L221 K222 R235 S236 H253 Y254
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0010521 telomerase inhibitor activity
GO:0043047 single-stranded telomeric DNA binding
GO:0098505 G-rich strand telomeric DNA binding
Biological Process
GO:0000723 telomere maintenance
GO:0016233 telomere capping
GO:0032210 regulation of telomere maintenance via telomerase
Cellular Component
GO:0000781 chromosome, telomeric region
GO:0000782 telomere cap complex
GO:0000783 nuclear telomere cap complex
GO:0005634 nucleus
GO:0005694 chromosome
GO:0032991 protein-containing complex

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component
External links
PDB RCSB:1phj, PDBe:1phj, PDBj:1phj
PDBsum1phj
PubMed12912928
UniProtP29549|TEBA_STENO Telomere-binding protein subunit alpha (Gene Name=MAC-56A)

[Back to BioLiP]