Structure of PDB 1p47 Chain A Binding Site BS02

Receptor Information
>1p47 Chain A (length=87) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ERPYACPVESCDRRFSRSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLT
THIRTHTGEKPFACDICGRKFARSDERKRHTKIHLRQ
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1p47 Constraints for Zinc Finger Linker Design as Inferred from X-ray Crystal Structure of Tandem Zif268-DNA Complexes
Resolution2.2 Å
Binding residue
(original residue number in PDB)		D120 D148 S175 D176 K179
Binding residue
(residue number reindexed from 1)		D19 D47 S74 D75 K78
Binding affinityPDBbind-CN: Kd=2.1fM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1p47, PDBe:1p47, PDBj:1p47
PDBsum1p47
PubMed12818197
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]