Structure of PDB 1osl Chain A Binding Site BS02

Receptor Information
>1osl Chain A (length=62) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
RCAQQLAGKQSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1osl Structure and flexibility adaptation in nonspecific and specific protein-DNA complexes.
ResolutionN/A
Binding residue
(original residue number in PDB)		Y7 Y17 N25 R51
Binding residue
(residue number reindexed from 1)		Y7 Y17 N25 R51
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1osl, PDBe:1osl, PDBj:1osl
PDBsum1osl
PubMed15256668
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]