Structure of PDB 1oe6 Chain A Binding Site BS02

Receptor Information

>1oe6 Chain A (length=244) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

SPADSFLKVELELNLKLSNLVFQDPVQYVYNPLVYAWAPHENYVQTYCKS
KKEVLFLGMNPGPFGMAQTGVPFGEVNHVRDWLQIEGPVSKPEVEHPKRR
IRGFECPQSEVSGARFWSLFKSLCGQPETFFKHCFVHNHCPLIFMNHSGK
NLTPTDLPKAQRDTLLEICDEALCQAVRVLGVKLVIGVGRFSEQRARKAL
MAEGIDVTVKGIMHPSPRNPQANKGWEGIVRGQLLELGVLSLLT

Ligand information

>1oe6 Chain F (length=12) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cggactcacggg

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1oe6 Structure and Specificity of the Vertebrate Anti-Mutator Uracil-DNA Glycosylase Smug1
Resolution	2.65 Å
Binding residue (original residue number in PDB)	K195 R198 P256
Binding residue (residue number reindexed from 1)	K159 R162 P220

Enzymatic activity

Enzyme Commision number

3.2.2.-

Gene Ontology

	Molecular Function
GO:0017065	single-strand selective uracil DNA N-glycosylase activity

	Biological Process
GO:0006284	base-excision repair

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1oe6, PDBe:1oe6, PDBj:1oe6
PDBsum	1oe6
PubMed	12820976
UniProt	Q9YGN6\|SMUG1_XENLA Single-strand selective monofunctional uracil DNA glycosylase (Gene Name=smug1)

[Back to BioLiP]