Structure of PDB 1o4x Chain A Binding Site BS02

Receptor Information
>1o4x Chain A (length=129) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
EEPSDLEELEQFAKTFKQRRIKLGFTQGDVGLAMGKLYGNDFSQTTISRF
EALNLSFKNMAKLKPLLEKWLNDAESIETNIRVALEKSFLENQKPTSEEI
TMIADQLNMEKEVIRVWFCNRRQKEKRIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1o4x Molecular basis for synergistic transcriptional activation by Oct1 and Sox2 revealed from the solution structure of the 42-kDa Oct1.Sox2.Hoxb1-DNA ternary transcription factor complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		D45 F46 S47 T49 K62 N63 Q157
Binding residue
(residue number reindexed from 1)		D41 F42 S43 T45 K58 N59 Q123
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1o4x, PDBe:1o4x, PDBj:1o4x
PDBsum1o4x
PubMed14559893
UniProtP14859|PO2F1_HUMAN POU domain, class 2, transcription factor 1 (Gene Name=POU2F1)

[Back to BioLiP]