Structure of PDB 1nvp Chain A Binding Site BS02

Receptor Information
>1nvp Chain A (length=180) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPQLQNIVSTVNLGCKLDLKTIALRARNAEYNPKRFAAVIMRIREPR
TTALIFSSGKMVCTGAKSEEQSRLAARKYARVVQKLGFPAKFLDFKIQNM
VGSCDVKFPIRLEGLVLTHQQFSSYEPELFPGLIYRMIKPRIVLLIFVSG
KVVLTGAKVRAEIYEAFENIYPILKGFRKT
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nvp Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
Resolution2.1 Å
Binding residue
(original residue number in PDB)		Q166 N167 R196 F197 R203 T210 L212 T222 V259 F288 P289 F305 S307 K309 V311
Binding residue
(residue number reindexed from 1)		Q8 N9 R38 F39 R45 T52 L54 T64 V101 F130 P131 F147 S149 K151 V153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nvp, PDBe:1nvp, PDBj:1nvp
PDBsum1nvp
PubMed12972251
UniProtP20226|TBP_HUMAN TATA-box-binding protein (Gene Name=TBP)

[Back to BioLiP]