Structure of PDB 1nkp Chain A Binding Site BS02

Receptor Information

>1nkp Chain A (length=88) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

GHMNVKRRTHNVLERQRRNELKRSFFALRDQIPELENNEKAPKVVILKKA
TAYILSVQAEEQKLISEEDLLRKRREQLKHKLEQLGGC

Ligand information

>1nkp Chain G (length=19) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgagtagcacgtgctactc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1nkp X-ray structures of Myc-Max and Mad-Max recognizing DNA: Molecular bases of regulation by proto-oncogenic transcription factors
Resolution	1.8 Å
Binding residue (original residue number in PDB)	R903 H906 N907 E910 R914 P938 K939
Binding residue (residue number reindexed from 1)	R7 H10 N11 E14 R18 P42 K43
Binding affinity	PDBbind-CN: Kd=90nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1nkp, PDBe:1nkp, PDBj:1nkp
PDBsum	1nkp
PubMed	12553908
UniProt	P01106\|MYC_HUMAN Myc proto-oncogene protein (Gene Name=MYC)

[Back to BioLiP]