Structure of PDB 1nh2 Chain A Binding Site BS02

Receptor Information
>1nh2 Chain A (length=180) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SGIVPTLQNIVATVTLGCRLDLKTVALHARNAEYNPKRFAAVIMRIREPK
TTALIFASGKMVVTGAKSEDDSKLASRKYARIIQKIGFAAKFTDFKIQNI
VGSCDVKFPIRLEGLAFSHGTFSSYEPELFPGLIYRMVKPKIVLLIFVSG
KIVLTGAKQREEIYQAFEAIYPVLSEFRKM
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1nh2 Novel interactions between the components of human and yeast TFIIA/TBP/DNA complexes.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		Q68 N69 F99 I103 R105 T112 L114 T124 V161 F190 P191 F207 S209 K211 V213
Binding residue
(residue number reindexed from 1)		Q8 N9 F39 I43 R45 T52 L54 T64 V101 F130 P131 F147 S149 K151 V153
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006352 DNA-templated transcription initiation

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1nh2, PDBe:1nh2, PDBj:1nh2
PDBsum1nh2
PubMed12972251
UniProtP13393|TBP_YEAST TATA-box-binding protein (Gene Name=SPT15)

[Back to BioLiP]