Structure of PDB 1n6j Chain A Binding Site BS02

Receptor Information
>1n6j Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GRKKIQISRILDQRNRQVTFTKRKFGLMKKAYELSVLCDCEIALIIFNSA
NRLFQYASTDMDRVLLKYTEYSEPHESRTNTDILETLKRRGIG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1n6j Sequence-specific recruitment of transcriptional co-repressor Cabin1 by myocyte enhancer factor-2
Resolution2.2 Å
Binding residue
(original residue number in PDB)		G2 R3 K4 I6 R24 K30
Binding residue
(residue number reindexed from 1)		G1 R2 K3 I5 R23 K29
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000977 RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0003677 DNA binding
GO:0046983 protein dimerization activity
Biological Process
GO:0045944 positive regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1n6j, PDBe:1n6j, PDBj:1n6j
PDBsum1n6j
PubMed12700764
UniProtQ02080|MEF2B_HUMAN Myocyte-specific enhancer factor 2B (Gene Name=MEF2B)

[Back to BioLiP]