Structure of PDB 1mow Chain A Binding Site BS02

Receptor Information
>1mow Chain A (length=248) Species: 2275,3055 [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ENVSGISAYLLGLIWGDGGLYKLKYKGNRSEYRVVITQKSENLIKQFIAP
RMQFLIDELNVKSKIQIVKGDTRYELRVSSKKLYYYFANMLERIRLFNGN
RFLAYLAGIVDGDGSIIAQIKPNQSYKFKHQLSLTFQVTQKTERRWFLDK
LVDEIGVGYVRDRGSVSDYILSEIKPLHNFLTQLQPFLNFKQKQANLVLK
IIEQLPSAKESPDKFLEVCTWVDQIAALNDSKTRKTTSETVRAVLDSL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1mow Design, Activity and Structure of a Highly Specific Artificial Endonuclease
Resolution2.4 Å
Binding residue
(original residue number in PDB)		D21 N32 R33 S34 E35 Y36 R37 S67 K68 Q70 D75 R81 S83 S84 K85 G116 D117 G118 S119 I121 Q123 N127 Q141 T143 Q144 K145 R167 N233 D234 S235 K239
Binding residue
(residue number reindexed from 1)		D17 N28 R29 S30 E31 Y32 R33 S63 K64 Q66 D71 R77 S79 S80 K81 G112 D113 G114 S115 I117 Q119 N123 Q137 T139 Q140 K141 R163 N229 D230 S231 K235
Enzymatic activity
Catalytic site (original residue number in PDB) G116 D117
Catalytic site (residue number reindexed from 1) G112 D113
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0042802 identical protein binding
GO:0046872 metal ion binding
Biological Process
GO:0006314 intron homing
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1mow, PDBe:1mow, PDBj:1mow
PDBsum1mow
PubMed12419232
UniProtP05725|DNE1_CHLRE DNA endonuclease I-CreI;
P21505|DMO1_DESMO Homing endonuclease I-DmoI

[Back to BioLiP]