Structure of PDB 1mnn Chain A Binding Site BS02

Receptor Information

>1mnn Chain A (length=290) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

VILTQLNEDGTTSNYFDKRKLKIAPRSTLQFKVGPPFELVRDYCPVVESH
TGRTLDLRIIPRIDRGFDHIDEEWVGYKRNYFTLVSTFETANCDLDTFLK
SSFDLLVGRLRVQYFAIKIKAKNDDDDTEINLVQHTAKRDKGPQFCPSVC
PLVPSPLPKHQTIREASNVRNITKMKKYDSTFYLHRDHVNYEEYGVDSLL
FSYPEDSIQKVARYERVQFASSISVKKPSQQNKHFSLHVILGAVVDPDGI
PYDELALKNGSKGMFVYLQEMKTPPLIIRGRSPSNYASSQ

Ligand information

>1mnn Chain C (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

agtttttgtgtcgc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mnn Structure of the sporulation-specific transcription factor Ndt80 bound to DNA
Resolution	1.4 Å
Binding residue (original residue number in PDB)	K50 K54 P57 R58 R97 R111 N112 Y113 A175 K176 R177 N206 R254 Y331 S333
Binding residue (residue number reindexed from 1)	K18 K22 P25 R26 R65 R79 N80 Y81 A137 K138 R139 N168 R216 Y286 S288

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1mnn, PDBe:1mnn, PDBj:1mnn
PDBsum	1mnn
PubMed	12411490
UniProt	P38830\|NDT80_YEAST Meiosis-specific transcription factor NDT80 (Gene Name=NDT80)

[Back to BioLiP]