Structure of PDB 1mdy Chain A Binding Site BS02

Receptor Information

>1mdy Chain A (length=68) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

MELKRKTTNADRRKAATMRERRRLSKVNEAFETLKRSTSSNPNQRLPKVE
ILRNAIRYIEGLQALLRD

Ligand information

>1mdy Chain F (length=14) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tcaacagctgttga

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1mdy Crystal structure of MyoD bHLH domain-DNA complex: perspectives on DNA recognition and implications for transcriptional activation.
Resolution	2.8 Å
Binding residue (original residue number in PDB)	R111 T115 R119 P145 K146
Binding residue (residue number reindexed from 1)	R13 T17 R21 P47 K48

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0046983	protein dimerization activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription
GO:0007517	muscle organ development

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1mdy, PDBe:1mdy, PDBj:1mdy
PDBsum	1mdy
PubMed	8181063
UniProt	P10085\|MYOD1_MOUSE Myoblast determination protein 1 (Gene Name=Myod1)

[Back to BioLiP]