Structure of PDB 1m5x Chain A Binding Site BS02

Receptor Information
>1m5x Chain A (length=161) Species: 141716 (Monomastix sp. OKE-1) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TLQPTEAAYIAGFLDGDGSIYAKLIPRPDYKDIKYQVSLAISFIQRKDKF
PYLQDIYDQLGKRGNLRKDRGDGIADYTIIGSTHLSIILPDLVPYLRIKK
KQANRILHIINLYPQAQKNPSKFLDLVKIVDDVQNLNKRADELKSTNYDR
LLEEFLKAGKI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1m5x Flexible DNA Target Site Recognition by Divergent Homing Endonuclease Isoschizomers I-CreI and I-MsoI
Resolution2.25 Å
Binding residue
(original residue number in PDB)		R32 D34 Y35 K36 Q41 N70 R72 R75 G86 Y118 R144
Binding residue
(residue number reindexed from 1)		R27 D29 Y30 K31 Q36 N65 R67 R70 G81 Y113 R139
Enzymatic activity
Catalytic site (original residue number in PDB) G21 D22
Catalytic site (residue number reindexed from 1) G16 D17
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0004519 endonuclease activity
GO:0046872 metal ion binding
Cellular Component
GO:0009507 chloroplast

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:1m5x, PDBe:1m5x, PDBj:1m5x
PDBsum1m5x
PubMed12758074
UniProtC0JWR6

[Back to BioLiP]