Structure of PDB 1lrr Chain A Binding Site BS02

Receptor Information
>1lrr Chain A (length=118) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
TIKDKVRAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESL
HGRTRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHI
MQSMQFPAELIEKVCGTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lrr Insights into negative modulation of E. coli replication initiation from the structure of SeqA-hemimethylated DNA complex
Resolution2.65 Å
Binding residue
(original residue number in PDB)		R86 A87 V88 R116 K138 N152 T153
Binding residue
(residue number reindexed from 1)		R23 A24 V25 R53 K75 N89 T90
Binding affinityPDBbind-CN: Kd=7uM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1lrr, PDBe:1lrr, PDBj:1lrr
PDBsum1lrr
PubMed12379844
UniProtP0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)

[Back to BioLiP]