Structure of PDB 1lo1 Chain A Binding Site BS02

Receptor Information

>1lo1 Chain A (length=90) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AIPKRLCLVCGDIASGYHYGVASCEACKAFFKRTIQGNIEYSCPATNECE
ITKRRRKSCQACRFMKALKVGMLKEGVRLDRVRGGRQKYK

Ligand information

>1lo1 Chain C (length=13) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

cgtgaccttgagc

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1lo1 Monomeric Complex of Human Orphan Estrogen Related Receptor-2 with DNA: A Pseudo-dimer Interface Mediates Extended Half-site Recognition
Resolution	N/A
Binding residue (original residue number in PDB)	E121 R129 R152 K153 Q156 R159 R179 G180 G181 R182
Binding residue (residue number reindexed from 1)	E25 R33 R56 K57 Q60 R63 R83 G84 G85 R86
Binding affinity	PDBbind-CN: Kd=7.1nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003700	DNA-binding transcription factor activity
GO:0008270	zinc ion binding
GO:0043565	sequence-specific DNA binding

	Biological Process
GO:0006355	regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process

External links

PDB	RCSB:1lo1, PDBe:1lo1, PDBj:1lo1
PDBsum	1lo1
PubMed	12654265
UniProt	O95718\|ERR2_HUMAN Steroid hormone receptor ERR2 (Gene Name=ESRRB)

[Back to BioLiP]