Structure of PDB 1lj2 Chain A Binding Site BS02

Receptor Information
>1lj2 Chain A (length=106) Species: 10923 (Simian rotavirus A/SA11) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
HSLQNVIPQQQAHIAELQVYNNKLERDLQNKIGSLTSSIEWYLRSMELDP
EIKADIEQQINSIDAINPLHAFDDLESVIRNLISDYDKLFLMFKGLIQRS
NYQYSF
Ligand information
>1lj2 Chain D (length=27) Species: 9606 (Homo sapiens) [Search peptide sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]
PKRERKTIRIRDPNQGGKDITEEIMSG
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lj2 Recognition of eIF4G by rotavirus NSP3 reveals a basis for mRNA circularization.
Resolution2.38 Å
Binding residue
(original residue number in PDB)		D261 D291 M298 G301 Q304 R305
Binding residue
(residue number reindexed from 1)		D55 D85 M92 G95 Q98 R99
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1lj2, PDBe:1lj2, PDBj:1lj2
PDBsum1lj2
PubMed12086624
UniProtP03536|NSP3_ROTS1 Non-structural protein 3

[Back to BioLiP]