Structure of PDB 1lei Chain A Binding Site BS02

Receptor Information

>1lei Chain A (length=273) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]

AYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTG
PGTVRISLVTKDPPHRPHPHELVGKDCRDGYYEADLCPDRSIHSFQNLGI
QCVKKRDLEQAISQRIQTNNNPFHVPIEEQRGDYDLNAVRLCFQVTVRDP
AGRPLLLTPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGDEIFLLCDK
VQKEDIEVYFTGPGWEARGSFSQADVHRQVAIVFRTPPYADPSLQAPVRV
SMQLRRPSDRELSEPMEFQYLPD

Ligand information

>1lei Chain D (length=17) [Search DNA sequence] [Download ligand structure] [Download structure with residue number starting from 1] [View ligand structure]

tctguacuuuccctgag

Receptor-Ligand Complex Structure

Global view

Local view

Structure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

PDB	1lei The kB DNA sequence from the HIV Long Terminal Repeat functions as an allosteric regulator of HIV transcription
Resolution	2.7 Å
Binding residue (original residue number in PDB)	R33 R35 S42 S45
Binding residue (residue number reindexed from 1)	R15 R17 S24 S27
Binding affinity	PDBbind-CN: Kd=0.8nM

Enzymatic activity

Enzyme Commision number

Gene Ontology

	Molecular Function
GO:0003677	DNA binding
GO:0003700	DNA-binding transcription factor activity

	Biological Process
GO:0006355	regulation of DNA-templated transcription

	Cellular Component
GO:0005737	cytoplasm

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:1lei, PDBe:1lei, PDBj:1lei
PDBsum	1lei
PubMed	11970949
UniProt	Q04207\|TF65_MOUSE Transcription factor p65 (Gene Name=Rela)

[Back to BioLiP]