Structure of PDB 1lcd Chain A Binding Site BS02

Receptor Information
>1lcd Chain A (length=51) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MKPVTLYDVAEYAGVSYQTVSRVVNQASHVSAKTREKVEAAMAELNYIPN
R
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1lcd Structure of the complex of lac repressor headpiece and an 11 base-pair half-operator determined by nuclear magnetic resonance spectroscopy and restrained molecular dynamics.
ResolutionN/A
Binding residue
(original residue number in PDB)		T5 L6 Y17 Q18 S21 R22 N25 Q26 Y47 N50
Binding residue
(residue number reindexed from 1)		T5 L6 Y17 Q18 S21 R22 N25 Q26 Y47 N50
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1lcd, PDBe:1lcd, PDBj:1lcd
PDBsum1lcd
PubMed8230225
UniProtP03023|LACI_ECOLI Lactose operon repressor (Gene Name=lacI)

[Back to BioLiP]