Structure of PDB 1l6o Chain A Binding Site BS02

Receptor Information
>1l6o Chain A (length=95) Species: 8355 (Xenopus laevis) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MIITVTLNMEKYNFLGISIVGQSNERGDGGIYIGSIMKGGAVAADGRIEP
GDMLLQVNDINFENMSNDDAVRVLRDIVHKPGPIVLTVAKLEHHH
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1l6o Dapper, a Dishevelled-associated antagonist of beta-catenin and JNK signaling, is required for notochord formation
Resolution2.2 Å
Binding residue
(original residue number in PDB)		Q272 Y282 L341 E342 H343 H345
Binding residue
(residue number reindexed from 1)		Q22 Y32 L91 E92 H93 H95
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0016055 Wnt signaling pathway

View graph for
Biological Process
External links
PDB RCSB:1l6o, PDBe:1l6o, PDBj:1l6o
PDBsum1l6o
PubMed11970895
UniProtP51142|DVL2_XENLA Segment polarity protein dishevelled homolog DVL-2 (Gene Name=dvl2)

[Back to BioLiP]