Structure of PDB 1l2d Chain A Binding Site BS02

Receptor Information

>1l2d Chain A (length=259) Species: 1422 (Geobacillus stearothermophilus)

PELPEVETIRRTLLPLIVGKTIEDVRIFWPNIIRHPRDSEAFAARMIGQT
VRGLERRGKFLKFLLDRDALISHLRMEGRYAVASALEPLEPHTHVVFCFT
DGSELRYRDVRKFGTMHVYAKEEADRRPPLAELGPEPLSPAFSPAVLAER
AVKTKRSVKALLLDQTVVAGFGNIYVDESLFRAGILPGRPAASLSSKEIE
RLHEEMVATIGEAVMKGGSFQHHLYVYGRQGNPCKRCGTPIEKTVVAGRG
THYCPRCQR

Ligand information

>1l2d Chain C (length=12)

gtccacgtctac

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1l2d Structural insights into lesion recognition and repair by the bacterial 8-oxoguanine DNA glycosylase MutM.
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): E3 K60 H74 R76 M77 R112 Q166 G173 N174 I175 Y242 K258 R264
• Binding residue (residue number reindexed from 1): E2 K59 H73 R75 M76 R111 Q165 G172 N173 I174 Y227 K243 R249

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Sun Nov 24 21:12:20 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1435     title=pdb2title(pdbid)

   1436     if bs.startswith("BS"):

=> 1437         pubmed,uniprot=display_interaction(pdbid,asym_id,bs,title)

   1438     else:

   1439         if lig3:

pubmed = '', uniprot = '', display_interaction = <function display_interaction>, pdbid = '1l2d', asym_id = 'A', bs = 'BS02', title = 'Structural insights into lesion recognition and ... the bacterial 8-oxoguanine DNA glycosylase MutM.'

 /var/www/html/BioLiP/pdb.cgi in display_interaction(pdbid='1l2d', asym_id='A', bs='BS02', title='Structural insights into lesion recognition and ... the bacterial 8-oxoguanine DNA glycosylase MutM.')

   1295         display_ec(ec,csaOrig,csaRenu)

   1296     if go:

=> 1297         display_go(go,uniprot,pdbid,asym_id)

   1298     return pubmed,uniprot

   1299 

global display_go = <function display_go>, go = '0003676,0003677,0003684,0003906,0006281,0006284,0008270,0008534,0016799,0019104', uniprot = '', pdbid = '1l2d', asym_id = 'A'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0003676,0003677,0003684,0003906,0006281,0006284,0008270,0008534,0016799,0019104', uniprot='', pdbid='1l2d', asym_id='A')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>