Structure of PDB 1kqq Chain A Binding Site BS02

Receptor Information
>1kqq Chain A (length=131) Species: 7227 (Drosophila melanogaster) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GWSFEEQFKQVRQLYEINDDPKRKEFLDDLFSFMQKRGTPINRLPIMAKS
VLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAALTLRTQY
MKYLYPYECEKKNLSTPAELQAAIDGNRREG
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kqq The structure of the Dead ringer-DNA complex reveals how AT-rich interaction domains (ARIDs) recognize DNA.
ResolutionN/A
Binding residue
(original residue number in PDB)		K76 W78 Q79 T92 S93 A95 L96 R99 N129
Binding residue
(residue number reindexed from 1)		K74 W76 Q77 T90 S91 A93 L94 R97 N127
Binding affinityPDBbind-CN: Kd=28nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006357 regulation of transcription by RNA polymerase II

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kqq, PDBe:1kqq, PDBj:1kqq
PDBsum1kqq
PubMed11867548
UniProtQ24573|DRI_DROME Protein dead ringer (Gene Name=retn)

[Back to BioLiP]