Structure of PDB 1kc6 Chain A Binding Site BS02

Receptor Information
>1kc6 Chain A (length=249) Species: 727 (Haemophilus influenzae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SFIKPIYQDINSILIGQKVKRPAAGEPFEKLVYKFLKENLSDLTFKQYEY
LNDLFMKNPAIIGHEARYKLFNSPTLLFLLSRGKAATENWSIENLFEEKQ
NDTADILLVKDQFYELLDVKTRNISKSAQAPNIISAYKLAQTCAKMIDNK
EFDLFDINYLEVDWELNGEDLVCVSTSFAELFKSEPSELYINWAAAMQIQ
FHVRDLDQGFNGTREEWAKSYLKHFVTQAEQRAISMIDKFVKPFKKYIL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kc6 Sequence selectivity and degeneracy of a restriction endonuclease mediated by DNA intercalation.
Resolution2.6 Å
Binding residue
(original residue number in PDB)		Q109 N110 D127 T130 N132 K135 S136 A137 A139 P140 N141 S144 Y146 K147 A205 M206 Q207
Binding residue
(residue number reindexed from 1)		Q100 N101 D118 T121 N123 K126 S127 A128 A130 P131 N132 S135 Y137 K138 A196 M197 Q198
Enzymatic activity
Enzyme Commision number 3.1.21.4: type II site-specific deoxyribonuclease.
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity
GO:0009036 type II site-specific deoxyribonuclease activity
Biological Process
GO:0009307 DNA restriction-modification system

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1kc6, PDBe:1kc6, PDBj:1kc6
PDBsum1kc6
PubMed11742344
UniProtP17743|T2C2_HAEIF Type II restriction enzyme HincII (Gene Name=hincIIR)

[Back to BioLiP]