Structure of PDB 1kb4 Chain A Binding Site BS02

Receptor Information
>1kb4 Chain A (length=93) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKD
NRRHCQACRLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEE
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1kb4 Structural basis of VDR-DNA interactions on direct repeat response elements.
Resolution2.8 Å
Binding residue
(original residue number in PDB)
G43 F47 R50 R73 R74 R80 I107
Binding residue
(residue number reindexed from 1)
G22 F26 R29 R52 R53 R59 I86
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1kb4, PDBe:1kb4, PDBj:1kb4
PDBsum1kb4
PubMed11980721
UniProtP11473|VDR_HUMAN Vitamin D3 receptor (Gene Name=VDR)

[Back to BioLiP]