Structure of PDB 1k78 Chain A Binding Site BS02

Receptor Information
>1k78 Chain A (length=124) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
GVNQLGGVFVNGRPLPDVVRQRIVELAHQGVRPCDISRQLRVSHGCVSKI
LGRYYETGSIKPGVIGGSKPKVATPKVVEKIAEYKRQNPTMFAWEIRDRL
LAERVCDNDTVPSVSSINRIIRTK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1k78 Structural studies of Ets-1/Pax5 complex formation on DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		N21 Q22 F27 G30 L33 S61 H62 C64 R71 P80 G81 V82 I83 G84 G85 F110 A111 R140
Binding residue
(residue number reindexed from 1)		N3 Q4 F9 G12 L15 S43 H44 C46 R53 P62 G63 V64 I65 G66 G67 F92 A93 R122
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1k78, PDBe:1k78, PDBj:1k78
PDBsum1k78
PubMed11779502
UniProtQ02548|PAX5_HUMAN Paired box protein Pax-5 (Gene Name=PAX5)

[Back to BioLiP]