Structure of PDB 1jk1 Chain A Binding Site BS02

Receptor Information
>1jk1 Chain A (length=85) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RPYACPVESCDRRFSRSAELTRHIRIHTGQKPFQCRICMRNFSRSDHLTT
HIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1jk1 Rearrangement of side-chains in a Zif268 mutant highlights the complexities of zinc finger-DNA recognition.
Resolution1.9 Å
Binding residue
(original residue number in PDB)		D148 S175 D176 K179
Binding residue
(residue number reindexed from 1)		D46 S73 D74 K77
Binding affinityPDBbind-CN: Kd=26pM
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1jk1, PDBe:1jk1, PDBj:1jk1
PDBsum1jk1
PubMed11800559
UniProtP08046|EGR1_MOUSE Early growth response protein 1 (Gene Name=Egr1)

[Back to BioLiP]