Structure of PDB 1j5n Chain A Binding Site BS02

Receptor Information
>1j5n Chain A (length=93) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MVTPREPKKRTTRKKKDPNAPKRALSAYMFFANENRDIVRSENPDITFGQ
VGKKLGEKWKALTPEEKQPYEAKAQADKKRYESEKELYNATLA
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j5n The S. cerevisiae architectural HMGB protein NHP6A complexed with DNA: DNA and protein conformational changes upon binding
ResolutionN/A
Binding residue
(original residue number in PDB)		T11 T12 R23 S26 Y28 F48 K53 W59 K60 K78 Y81 K85
Binding residue
(residue number reindexed from 1)		T11 T12 R23 S26 Y28 F48 K53 W59 K60 K78 Y81 K85
Binding affinityPDBbind-CN: Kd=7.5nM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0005515 protein binding
GO:0008301 DNA binding, bending
GO:0031491 nucleosome binding
GO:0032407 MutSalpha complex binding
Biological Process
GO:0001195 maintenance of transcriptional fidelity during transcription elongation by RNA polymerase III
GO:0006281 DNA repair
GO:0006325 chromatin organization
GO:0006338 chromatin remodeling
GO:0051123 RNA polymerase II preinitiation complex assembly
GO:0065004 protein-DNA complex assembly
GO:0070898 RNA polymerase III preinitiation complex assembly
Cellular Component
GO:0005634 nucleus
GO:0005694 chromosome
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1j5n, PDBe:1j5n, PDBj:1j5n
PDBsum1j5n
PubMed12381320
UniProtP11632|NHP6A_YEAST Non-histone chromosomal protein 6A (Gene Name=NHP6A)

[Back to BioLiP]