Structure of PDB 1j59 Chain A Binding Site BS02

Receptor Information

>1j59 Chain A (length=199) Species: 562 (Escherichia coli)

PTLEWFLSHCHIHKYPSKSTLIHQGEKAETLYYIVKGSVAVLIKDEEGKE
MILSYLNQGDFIGELGLFEEGQERSAWVRAKTACEVAEISYKKFRQLIQV
NPDILMRLSAQMARRLQVTSEKVGNLAFLDVTGRIAQTLLNLAKQPDAMT
HPDGMQIKITRQEIGQIVGCSRETVGRILKMLEDQNLISAHGKTIVVYG

Ligand information

>1j59 Chain F (length=17)

atatgtcacacttttcg

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1j59 Structure of the CAP-DNA complex at 2.5 angstroms resolution: a complete picture of the protein-DNA interface.
• Resolution: 2.5 Å
• Binding residue (original residue number in PDB): K26 D138 V139 S179 E181 T182
• Binding residue (residue number reindexed from 1): K18 D130 V131 S171 E173 T174

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003680 minor groove of adenine-thymine-rich DNA binding
• GO:0003700 DNA-binding transcription factor activity
• GO:0005515 protein binding
• GO:0008301 DNA binding, bending
• GO:0030552 cAMP binding
• GO:0042802 identical protein binding
• GO:0043565 sequence-specific DNA binding

Biological Process

• GO:0006351 DNA-templated transcription
• GO:0006355 regulation of DNA-templated transcription
• GO:0045013 carbon catabolite repression of transcription
• GO:0045892 negative regulation of DNA-templated transcription
• GO:0045893 positive regulation of DNA-templated transcription

Cellular Component

• GO:0005829 cytosol
• GO:0032993 protein-DNA complex

External links

• PDB: RCSB:1j59, PDBe:1j59, PDBj:1j59
• PDBsum: 1j59
• PubMed: 8757802
• UniProt: P0ACJ8|CRP_ECOLI DNA-binding transcriptional dual regulator CRP (Gene Name=crp)