Structure of PDB 1j55 Chain A Binding Site BS02

Receptor Information

>1j55 Chain A (length=88) Species: 9606 (Homo sapiens)

MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLDAVDK
LLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGL

Ligand information

• Ligand ID: CA
• InChI: InChI=1S/Ca/q+2
• InChIKey: BHPQYMZQTOCNFJ-UHFFFAOYSA-N
• SMILES:
  CACTVS 3.341: [Ca++]
  ACDLabs 10.04
  OpenEye OEToolkits 1.5.0: [Ca+2]
• Formula: Ca
• Name: CALCIUM ION
• DrugBank: DB14577
• PDB chain: 1j55 Chain A Residue 102

Receptor-Ligand Complex Structure

Structure summary

• PDB: 1j55 The Crystal Structure at 2A Resolution of the Ca2+-binding Protein S100P
• Resolution: 2.0 Å
• Binding residue (original residue number in PDB): D62 N64 D66 Q68 E73
• Binding residue (residue number reindexed from 1): D56 N58 D60 Q62 E67
• Annotation score: 4

Gene Ontology

Molecular Function

• GO:0000287 magnesium ion binding
• GO:0005509 calcium ion binding
• GO:0005515 protein binding
• GO:0042803 protein homodimerization activity
• GO:0045296 cadherin binding
• GO:0046872 metal ion binding
• GO:0046914 transition metal ion binding
• GO:0048306 calcium-dependent protein binding

Biological Process

• GO:0043542 endothelial cell migration

Cellular Component

• GO:0005576 extracellular region
• GO:0005634 nucleus
• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005886 plasma membrane
• GO:0031528 microvillus membrane
• GO:0034774 secretory granule lumen
• GO:0042995 cell projection
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:1j55, PDBe:1j55, PDBj:1j55
• PDBsum: 1j55
• PubMed: 12507480
• UniProt: P25815|S100P_HUMAN Protein S100-P (Gene Name=S100P)