Structure of PDB 1j47 Chain A Binding Site BS02

Receptor Information
>1j47 Chain A (length=85) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MQDRVKRPINAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAE
KWPFFQEAQKLQAMHREKYPNYKYRPRRKAKMLPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j47 Structural basis for SRY-dependent 46-X,Y sex reversal: modulation of DNA bending by a naturally occurring point mutation.
ResolutionN/A
Binding residue
(original residue number in PDB)		N10 F12 S33 S36 K37 W43 K44 F55 Q62 Y74
Binding residue
(residue number reindexed from 1)		N10 F12 S33 S36 K37 W43 K44 F55 Q62 Y74
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1j47, PDBe:1j47, PDBj:1j47
PDBsum1j47
PubMed11563911
UniProtQ05066|SRY_HUMAN Sex-determining region Y protein (Gene Name=SRY)

[Back to BioLiP]