Structure of PDB 1j3e Chain A Binding Site BS02

Receptor Information
>1j3e Chain A (length=115) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
PLGSAMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGR
TRVYFAADEQTLLKNGNQTKPKHVPGTPYWVITNTNTGRKCSMIEHIMQS
MQFPAELIEKVCGTI
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1j3e Structural and biochemical analyses of hemimethylated DNA binding by the SeqA protein
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G50 R51 R53 Y55 N68 N85 R90
Binding residue
(residue number reindexed from 1)		G49 R50 R52 Y54 N67 N84 R89
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1j3e, PDBe:1j3e, PDBj:1j3e
PDBsum1j3e
PubMed14704346
UniProtP0AFY8|SEQA_ECOLI Negative modulator of initiation of replication (Gene Name=seqA)

[Back to BioLiP]