Structure of PDB 1iv6 Chain A Binding Site BS02

Receptor Information
>1iv6 Chain A (length=57) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKRQAWLWEEDKNLRSGVRKYGEGNWSKILLHYKFNNRTSVMLKDRWRTM
KKLKLIS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1iv6 Solution structure of a telomeric DNA complex of human TRF1.
ResolutionN/A
Binding residue
(original residue number in PDB)
R380 Q381 W383 V418 M419 D422 R423 L430 K431
Binding residue
(residue number reindexed from 1)
R3 Q4 W6 V41 M42 D45 R46 L53 K54
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1iv6, PDBe:1iv6, PDBj:1iv6
PDBsum1iv6
PubMed11738049
UniProtP54274|TERF1_HUMAN Telomeric repeat-binding factor 1 (Gene Name=TERF1)

[Back to BioLiP]