Structure of PDB 1ihf Chain A Binding Site BS02

Receptor Information
>1ihf Chain A (length=96) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
ALTKAEMSEYLFDKLGLSKRDAKELVELFFEEIRRALENGEQVKLSGFGN
FDLRDKNQRPGRNPKTGEDIPITARRVVTFRPGQKLKSRVENASPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ihf Crystal structure of an IHF-DNA complex: a protein-induced DNA U-turn.
Resolution2.5 Å
Binding residue
(original residue number in PDB)		G48 K86
Binding residue
(residue number reindexed from 1)		G47 K85
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001216 DNA-binding transcription activator activity
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0043565 sequence-specific DNA binding
Biological Process
GO:0006310 DNA recombination
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0006417 regulation of translation
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol
GO:0009295 nucleoid
GO:0032993 protein-DNA complex
GO:1990177 IHF-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1ihf, PDBe:1ihf, PDBj:1ihf
PDBsum1ihf
PubMed8980235
UniProtP0A6X7|IHFA_ECOLI Integration host factor subunit alpha (Gene Name=ihfA)

[Back to BioLiP]