Structure of PDB 1ign Chain A Binding Site BS02

Receptor Information
>1ign Chain A (length=189) Species: 4932 (Saccharomyces cerevisiae) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KASFTDEEDEFILDVVRKNPTRRTTHTLYDEISHYVPNHTGNSIRHRFRV
YLSKRLEYVYEVDKFGKLVRDDDGNLIKTKVLPPSIKRKFSADEDYTLAI
AVKKQFYRDLFQIDPDTGRSLIRTQSRRGPIAREFFKHFAEEHAAHTENA
WRDRFRKFLLAYGIDDYISYYEAEEPMKNLTPTPGNYNS
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ign The crystal structure of the DNA-binding domain of yeast RAP1 in complex with telomeric DNA.
Resolution2.25 Å
Binding residue
(original residue number in PDB)		K360 T383 T384 H385 T386 R404 R408 S444 I445 K446 R518 P520 I521 R523 E524 E538 R542 R546 P589 G590
Binding residue
(residue number reindexed from 1)		K1 T24 T25 H26 T27 R45 R49 S85 I86 K87 R128 P130 I131 R133 E134 E148 R152 R156 P184 G185
Binding affinityPDBbind-CN: Kd=13pM
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Biological Process
GO:0000723 telomere maintenance

View graph for
Molecular Function
View graph for
Biological Process
External links
PDB RCSB:1ign, PDBe:1ign, PDBj:1ign
PDBsum1ign
PubMed8620531
UniProtP11938|RAP1_YEAST DNA-binding protein RAP1 (Gene Name=RAP1)

[Back to BioLiP]