Structure of PDB 1ig7 Chain A Binding Site BS02

Receptor Information
>1ig7 Chain A (length=58) Species: 10090 (Mus musculus) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
RKPRTPFTTAQLLALERKFRQKQYLSIAERAEFSSSLSLTETQVKIWFQN
RRAKAKRL
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ig7 Crystal structure of the Msx-1 homeodomain/DNA complex
Resolution2.2 Å
Binding residue
(original residue number in PDB)
R102 R105 Y125 R131 K146 Q150 R153
Binding residue
(residue number reindexed from 1)
R1 R4 Y24 R30 K45 Q49 R52
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000981 DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0003677 DNA binding
Biological Process
GO:0006355 regulation of DNA-templated transcription

View graph for
Molecular Function

View graph for
Biological Process
External links
PDB RCSB:1ig7, PDBe:1ig7, PDBj:1ig7
PDBsum1ig7
PubMed11580277
UniProtP13297|MSX1_MOUSE Homeobox protein MSX-1 (Gene Name=Msx1)

[Back to BioLiP]