Structure of PDB 1ig4 Chain A Binding Site BS02

Receptor Information
>1ig4 Chain A (length=75) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
MAEDWLDCPALGPGWKRREVFRKSGATCGRSDTYYQSPTGDRIRSKVELT
RYLGPACDLTLFDFKQGILCYPAPK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1ig4 Solution structure of the methyl-CpG binding domain of human MBD1 in complex with methylated DNA.
ResolutionN/A
Binding residue
(original residue number in PDB)		R44 S45 K46 V47 E48 F64
Binding residue
(residue number reindexed from 1)		R44 S45 K46 V47 E48 F64
Enzymatic activity
Enzyme Commision number ?
Gene Ontology

View graph for
Molecular Function
External links
PDB RCSB:1ig4, PDBe:1ig4, PDBj:1ig4
PDBsum1ig4
PubMed11371345
UniProtQ9UIS9|MBD1_HUMAN Methyl-CpG-binding domain protein 1 (Gene Name=MBD1)

[Back to BioLiP]