Structure of PDB 1i3j Chain A Binding Site BS02

Receptor Information
>1i3j Chain A (length=96) Species: 10665 (Tequatrovirus T4) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
KFCKCGVRIQTSAYTCSKCRNRSGENNSFFNHKHSDITKSKISEKMKGKK
PSNIKKISCDGVIFDCAADAARHFKISSGLVTYRVKSDKWNWFYIN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1i3j Intertwined structure of the DNA-binding domain of intron endonuclease I-TevI with its substrate.
Resolution2.2 Å
Binding residue
(original residue number in PDB)		A161 Y162 C164 S165 R168 S176 F177 H182 K193 P199 S200 S225 L228 Y231 K237
Binding residue
(residue number reindexed from 1)		A13 Y14 C16 S17 R20 S28 F29 H34 K45 P51 S52 S77 L80 Y83 K89
Enzymatic activity
Enzyme Commision number 3.1.-.-
Gene Ontology
Molecular Function
GO:0003677 DNA binding
GO:0004519 endonuclease activity

View graph for
Molecular Function
External links
PDB RCSB:1i3j, PDBe:1i3j, PDBj:1i3j
PDBsum1i3j
PubMed11447104
UniProtP13299|TEV1_BPT4 Intron-associated endonuclease 1 (Gene Name=ITEVIR)

[Back to BioLiP]