Structure of PDB 1hw2 Chain A Binding Site BS02

Receptor Information
>1hw2 Chain A (length=222) Species: 562 (Escherichia coli) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
SPAGFAEEYIIESIWNNRFPPGTILPAERELSELIGVTRTTLREVLQRLA
RDGWLTIQHGKPTKVNNFWETSGLNILETLARLDHESVPQLIDNLLSVRT
NISTIFIRTAFRQHPDKAQEVLATANEVADHADAFAELDYNIFRGLAFAS
GNPIYGLILNGMKGLYTRIGRHYFANPEARSLALGFYHKLSALCSEGAHD
QVYETVRRYGHESGEIWHRMQK
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hw2 The FadR.DNA complex. Transcriptional control of fatty acid metabolism in Escherichia coli.
Resolution3.25 Å
Binding residue
(original residue number in PDB)		A33 E34 R35 R45 R49 I63 H65 G66
Binding residue
(residue number reindexed from 1)		A27 E28 R29 R39 R43 I57 H59 G60
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0000062 fatty-acyl-CoA binding
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0042803 protein homodimerization activity
Biological Process
GO:0006355 regulation of DNA-templated transcription
GO:0006631 fatty acid metabolic process
GO:0019217 regulation of fatty acid metabolic process
GO:0045723 positive regulation of fatty acid biosynthetic process
GO:0045892 negative regulation of DNA-templated transcription
GO:0045893 positive regulation of DNA-templated transcription
Cellular Component
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:1hw2, PDBe:1hw2, PDBj:1hw2
PDBsum1hw2
PubMed11279025
UniProtP0A8V6|FADR_ECOLI Fatty acid metabolism regulator protein (Gene Name=fadR)

[Back to BioLiP]