Structure of PDB 1hrz Chain A Binding Site BS02

Receptor Information
>1hrz Chain A (length=73) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
DRVKRPMNAFIVWSRDQRRKMALENPRMRNSEISKQLGYQWKMLTEAEKW
PFFQEAQKLQAMHREKYPNYKYR
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hrz Molecular basis of human 46X,Y sex reversal revealed from the three-dimensional solution structure of the human SRY-DNA complex.
ResolutionN/A
Binding residue
(original residue number in PDB)		N10 F12 S33 Q62 R66
Binding residue
(residue number reindexed from 1)		N8 F10 S31 Q60 R64
Enzymatic activity
Enzyme Commision number ?
External links
PDB RCSB:1hrz, PDBe:1hrz, PDBj:1hrz
PDBsum1hrz
PubMed7774012
UniProtQ05066|SRY_HUMAN Sex-determining region Y protein (Gene Name=SRY)

[Back to BioLiP]