Structure of PDB 1hlo Chain A Binding Site BS02

Receptor Information
>1hlo Chain A (length=80) Species: 9606 (Homo sapiens) [Search protein sequence] [Download receptor structure] [Download structure with residue number starting from 1] [View receptor structure]
NDDIEVESDADKRAHHNALERKRRDHIKDSFHSLRDSVPSLQGEKASRAQ
ILDKATEYIQYMRRKNHTHQQDIDDLKRQN
Ligand information
Receptor-Ligand Complex Structure
Global viewLocal viewStructure summary

[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
[Spin on] [Spin off] [Reset]
[High quality] [Low quality]
[White background] [Black background]
PDB1hlo The crystal structure of an intact human Max-DNA complex: new insights into mechanisms of transcriptional control.
Resolution2.8 Å
Binding residue
(original residue number in PDB)		E22 R25
Binding residue
(residue number reindexed from 1)		E20 R23
Enzymatic activity
Enzyme Commision number ?
Gene Ontology
Molecular Function
GO:0046983 protein dimerization activity

View graph for
Molecular Function
External links
PDB RCSB:1hlo, PDBe:1hlo, PDBj:1hlo
PDBsum1hlo
PubMed9115440
UniProtP61244|MAX_HUMAN Protein max (Gene Name=MAX)

[Back to BioLiP]